PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G1876
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 282aa    MW: 32040.1 Da    PI: 9.0698
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G1876genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l  +++q+G+g+W++++ + g+ R+ k+c++rw +yl
      Gh_A07G1876 14 KGPWTPEEDLILMSYIQQHGPGNWRAVPTKTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding41.53.1e-1367112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ + E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_A07G1876  67 RGNFAENEEKMIIHLQALLGNR-WAAIASYLP-ERTDNNIKNYWNTHL 112
                      799999****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.37965IPR017930Myb domain
SuperFamilySSF466891.56E-2911108IPR009057Homeodomain-like
SMARTSM007177.9E-141363IPR001005SANT/Myb domain
PfamPF002492.3E-161461IPR001005SANT/Myb domain
CDDcd001676.89E-101661No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2365117IPR009057Homeodomain-like
SMARTSM007173.7E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129418.29766116IPR017930Myb domain
PfamPF002491.8E-1267112IPR001005SANT/Myb domain
CDDcd001671.93E-774111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRQPCCDKA GVKKGPWTPE EDLILMSYIQ QHGPGNWRAV PTKTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF AENEEKMIIH LQALLGNRWA AIASYLPERT DNNIKNYWNT HLKKKLKKLQ  120
GNEGSSRYGF SSSSSSYQIC RGQWERKLQT DIHMAKKDLS DALSPEKSSD HTSYPKPSGY  180
ASSTENIAKL LKGWMRNNPW KMADSTDYSE EGTDPMKEVK NSKEMAEAFQ SHLGFESLDS  240
SLSDISPSMS PEASLSQYES KQHVNAQSQL SMLEKWLFES ES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-25141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.23440.0boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO737617040.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1182430.0DQ118243.1 Gossypium hirsutum myb transcription factor MYB30 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441068.10.0PREDICTED: myb-related protein 306
SwissprotQ9SCU71e-105MYB30_ARATH; Transcription factor MYB30
TrEMBLQ2QDD50.0Q2QDD5_G
STRINGPOPTR_0017s11880.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-104myb domain protein 30